DPCstruct | MC12106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 13.59 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C8F595 | 1-154 | MDDLFERLTSSIDLSKTKIYPPPPRIVLCGGKHDVTNGEQRVSVRDALYRSAEIKGKGYYEHILLPENIFKFYQSSGYTDLLRFERD… |
| A0A5A7WF74 | 12-138 | AKIHVQAPSNIVFLCGGQRSDLSAPIPLSLRDAFLKILDFPIFRERELVQAEDITGKYDFFSTYEDILEFETDLAQIVELIILFCES… |
| A0A1F9XLZ6 | 26-141 | None |
| A0A2V9QV93 | 1-143 | None |
| A0A7U0SY35 | 14-119 | None |
| A0A231HM75 | 48-180 | None |
| A0A1I6QFN3 | 7-125 | None |
| A0A3S0F2T3 | 109-227 | None |
| A0A1C7W738 | 32-147 | None |
| A0A7M1B4V2 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.