DPCstruct | MC12105
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 145 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C8F4R7 | 1-129 | METVRHSCGHERKYRLNGPAHSVQRQIEHREAMPCPKCKKAQEEARFVAECEAAALANAEMGLPELTGTASQVSYAEKCRKEAVMFS… |
| A0A077MA47 | 1-137 | MGTGTETVTFATCGHTDRVQITWTGGREQRERKAAWVAANLTCPSCREIATAARGIAAIESGLVGSSKQCAWAEDIRTAYLARWDET… |
| A0A1H8JFV9 | 7-127 | None |
| A0A2H1KPZ4 | 1-171 | None |
| A0A3D9LID5 | 1-142 | None |
| A0A5M9ZHM3 | 4-137 | None |
| A0A1B0ZJ88 | 6-154 | None |
| A0A6P1RY22 | 1-161 | None |
| A0A4R7BW26 | 33-190 | None |
| A0A7X5HWL4 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.