DPCstruct | MC12104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 158 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0291 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C8F475 | 1-152 | MGMYEGLLRDFAVRTKANLEYIDEAWELQEREGLEDRRVFNVTQLINSCLGMVVFMSENGIAPNIPIQEFCPEMKFITRLDVRNSNR… |
| A0A235INB8 | 8-144 | QRDFIARTLEIVEQYEKYVMKCVSENQQFEVTLLINCLLGLLVLPKEHCYRSIPNKPIKELEEWGLSPDFIQDWGSEDHHTLPKFVK… |
| A0A3D0NZC5 | 1-152 | None |
| A0A1V5TK93 | 1-148 | None |
| A0A6A7KLD3 | 1-153 | None |
| A0A853HNH5 | 1-179 | None |
| Q1PY73 | 2-134 | None |
| A0A7U6KEL2 | 1-174 | None |
| A0A0Q6CB19 | 10-170 | None |
| A0A7Y4TPM1 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.