DPCstruct | MC12102
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 255 ± 44 aa |
| Standard deviation of domain lengths | 43.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 88.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2Q2I9 | 1-210 | MFGRGNAEAFDRQGWAYFARDVFDLFYPGYWDSWPSLNGAIGMTYETDGGGSRGLRWRREDGALVTLRDGIAKHFVASLATVETAVR… |
| A0A1W9P2S8 | 193-439 | QMPWLYHHYAGHDDNRDWFMFNLAETKAVTKLLYHDWIPQIHIDEHQMGSTGARLFIPPFMDPPLPNIHPLVWRGVALCGMNMAYDL… |
| A0A2V8MTI0 | 2-236 | None |
| A0A3D1BTK4 | 52-289 | None |
| A0A372IM54 | 205-518 | None |
| A0A5A7N324 | 226-554 | None |
| A0A2V8N4L9 | 138-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.