DPCstruct | MC1210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 162 ± 9 aa |
| Standard deviation of domain lengths | 9.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520L0Y1 | 98-253 | QLGKLELTVSYKKLKGSVLSYACDKYRPKSNPKVWSKNYLNILFLTDMPENKYTTAHATSRNYPHYMTSGKQRTSMGDIDWVHLQRA… |
| A0A5C5WYJ3 | 4-150 | GDYAVNSTSTVAVLNSDGYFTVFSGHPIDNYSEPSAPLLYLVELVDRVDTSTVTTSSSHGTYHSTLDHTWTTAHGDMQISLDWNRSS… |
| A0A7X7T9A8 | 18-187 | None |
| A0A3M0Z5F2 | 1-164 | None |
| L0D8A4 | 1-147 | None |
| A0A550GRD3 | 14-166 | None |
| A0A2V8FCE8 | 9-179 | None |
| A0A352FHF8 | 16-191 | None |
| A0A5C5UW29 | 37-204 | None |
| A0A5C5UU02 | 1-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.