DPCstruct | MC121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 238 ± 25 aa |
| Standard deviation of domain lengths | 24.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A501WK55 | 3-249 | GQLLLRGMLVGILAGLLAFGFARVFGEPQVARAVALEGEGGHHHGEAEAGEHDHDAAHDPGAGISRGTQAGIGLLTGTTVYGVALGG… |
| A0A075H4Q5 | 1-238 | MNAGYFIAIVLVSGFVAGTIHGAVNLAIVEPYLDEAIGIENQALFESEEAEDTPQFWVEYNSYRDWQKSGQLLAGGILGMSIGALFG… |
| A0A2D6T5P3 | 31-252 | None |
| A0A7L7M4E1 | 82-298 | None |
| A0A2E4QA56 | 3-212 | None |
| F1YG13 | 83-349 | None |
| A0A1H3J500 | 1-278 | None |
| A0A4P9S9X5 | 10-214 | None |
| A0A2T2RI92 | 31-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.