DPCstruct | MC12099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 172 ± 24 aa |
| Standard deviation of domain lengths | 24.09 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G8FUN3 | 2-145 | PEVVQWQVLGPEGPVQSGWAFTLRCTVNNRSLRYREREYGINLDWDKAEDLGNISFQTVDGAPLRYGDLVSVLVADGGHLRYGPRAN… |
| A0A838WBQ7 | 7-165 | PQSVMLWTLGGKQGNVRAQNAYTSNSGYSLLCSANKQHLTWVKQRVGVNLGYTSNAQERKVHFLLPDGKQRDILTGEPVAFGIGGGE… |
| A0A7Y4ZWI2 | 22-185 | None |
| A0A4R5QMZ0 | 13-205 | None |
| A0A4R8CQS4 | 61-232 | None |
| A0A395JN49 | 60-264 | None |
| A0A841BNC1 | 32-179 | None |
| A0A5B9Q864 | 69-256 | None |
| A0A5B9Q7Y6 | 20-241 | None |
| A0A1R4H9S5 | 122-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.