DPCstruct | MC12092
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 2.96 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 63.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R8Q4I0 | 1-63 | MSFVTIERKCSTVYPSLEQVFYWTTLCAIEDVKVVILGQDPYHHPGQAHGLAFSVLRPKSPPP |
| A0A2K5L9K3 | 59-120 | GFVAEERKHYTVYPPPHQVFTWTQMCDIRDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPP |
| B5XB63 | 1-64 | None |
| A0A090Q588 | 27-88 | None |
| A0A7J5ZVY4 | 92-154 | None |
| G5AVJ3 | 61-122 | None |
| A0A3P9H4T8 | 533-594 | None |
| A0A819CUQ3 | 752-814 | None |
| A0A455VBV4 | 1-52 | None |
| A0A2C9M032 | 156-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.