DPCstruct | MC1209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 202 ± 54 aa |
| Standard deviation of domain lengths | 54.15 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 75.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B9PMM5 | 575-691 | CSIGQRGSLQRNWTPQTVTWHASSLCHKPLFFENIQLERYGHSRGPFMQPIHSTFHFFRSIIFLPYNSAINPPNECQYSLGFYRPGN… |
| A0A5C5WTN0 | 64-268 | DTDGDRDMSGPERVADDDDDARANADLGNLDLDVDLEPNNERPSTQVVGGRFVLPELAAVSTSTKEIGNGSTPDGFRSEAPRPLMML… |
| A0A353ZET3 | 20-249 | None |
| A0A5C6ACJ7 | 139-353 | None |
| A0A5C6B155 | 41-307 | None |
| A0A142X997 | 1-294 | None |
| A0A3C0WF94 | 1-120 | None |
| A0A517ZKV1 | 293-415 | None |
| A0A5C5YNK8 | 23-239 | None |
| A0A1P8WJA7 | 416-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.