DPCstruct | MC12086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 87 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 70.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11871 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0GNS2 | 3-86 | KVQKVMVKELKVGMYVSGLDRSWLGTPFPLQGFLIDSESVKDTLKDLCEFVYVDFAKSDIAEPAPARPRATPRNSAHPQNARTT |
| A0A848U071 | 21-98 | VSETRWVHRNQLEIGMYVNELDKPWTETRFMFQGFRIDTPELLRQVQESCEYAQVQTDKLARISSNSATRLVGATRSH |
| A0A6N3UHL7 | 34-130 | None |
| A0A6S5A9V6 | 6-74 | None |
| A0A6N0X038 | 5-94 | None |
| A0A1G1HW29 | 1-82 | None |
| A0A6M4A5V1 | 7-108 | None |
| W5YU36 | 4-128 | None |
| A0A2E2KML9 | 11-94 | None |
| A0A365VP84 | 1-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.