DPCstruct | MC12085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 159 ± 16 aa |
| Standard deviation of domain lengths | 15.90 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.93 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0M899 | 162-315 | LPDAAGVGLPGGGEILTTAEQVAILDAQLDQGTAVFDDMILDEQEKQRSSARDNASAAQDAARNTPARHEPYENAVARKDGGLYGST… |
| A0A3D0GNG2 | 1-134 | MLDAELEATTSVFDQIIRSTQDQQRNEARTQSPATDLEVEPATESSNESYGAMPGRSAGSGAGGAPGAGGGMRSGQPASTAATAQYP… |
| A0A2A5WWP7 | 143-283 | None |
| A0A4R5LQR9 | 224-378 | None |
| A0A661G7X8 | 23-197 | None |
| A0A0S8BRN9 | 98-261 | None |
| A0A2W4MXD3 | 1-171 | None |
| A0A2D5QGY7 | 67-224 | None |
| A0A831ZHB6 | 19-197 | None |
| A0A1E8CL86 | 92-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.