DPCstruct | MC12083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 4.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N3U6X4 | 5-69 | RRMLAEAADYLTEDGVLVIEVGNSMVHVMAEWPEVDFEWVKFRHGGHGVFVLSAEQCRHFQSLFA |
| A0A3C7VZW8 | 2-65 | QRLLPTAAQHLEDHGLLLLEVGNSWPALEARYPRFPFTWVELERGGHGVAAITARELRDHAGAL |
| A0A7Y1W3B9 | 13-76 | None |
| A0A7Y3F4M7 | 38-101 | None |
| A0A355R5X5 | 202-266 | None |
| A0A379XP55 | 242-300 | None |
| A0A3S4LCS8 | 27-91 | None |
| A0A7Y3J6Q7 | 4-53 | None |
| A0A836NRU0 | 1-58 | None |
| A0A0A2VUU5 | 220-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.