DPCstruct | MC1208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 12.97 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q4H1I2 | 652-781 | GNVWHNHVSPFDVNGQDGVTPLDVLILINYINWNPHAPLLPPAPPLPPPYYDVNNDGYVTPHDVLLVINYINRQSSEAAEAEGIAAL… |
| A0A517MN03 | 379-473 | VQLPYFQNPVNRFDVDGNGRVEPQDALEIINQLNRRNGRSELVPGEEPTDLAFIDVDGDYLLIPLDALEVINRLNQLSRRVVGESLP… |
| A0A7Y2AQS6 | 142-264 | None |
| A0A2E8D4Q8 | 108-232 | None |
| A0A517NTI5 | 998-1133 | None |
| A0A517YNV7 | 742-849 | None |
| Q7UFE7 | 572-709 | None |
| F2APD9 | 304-441 | None |
| A0A7Y2AET8 | 831-961 | None |
| A0A2E1KPD2 | 49-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.