DPCstruct | MC12079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 98 ± 17 aa |
| Standard deviation of domain lengths | 16.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I6W852 | 28-118 | FDDAGAVLCAQDIGQPLEACDARVARSGAGTAAVRVDFPNGFSRILKFSDGGFVSANATMSGVGTDIDWQRDGDRLILRVDDQRYEL… |
| A0A182AU11 | 200-291 | FDASGELPCSLGSGQPMGRCGFQVARAGGGYATVVISLPDGRRRTVYFRLGQAIGNASAEAAPTGPFQASREGDLTRIQIGDERFEI… |
| A0A6I4SW20 | 70-185 | None |
| A0A245ZIF3 | 3-69 | None |
| A0A6I4TKP7 | 32-117 | None |
| A0A1L3SRI3 | 440-528 | None |
| A0A6N9RMW5 | 219-313 | None |
| A0A7H9BK13 | 1-98 | None |
| A0A6P1DWD2 | 3-126 | None |
| A0A1M2ZKE7 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.