DPCstruct | MC12078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 227 ± 16 aa |
| Standard deviation of domain lengths | 16.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | PF15024- PF15027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9MER9 | 1-225 | MEELLKLQLEKDEKKIQQFKSVPPPPPLKDCKAEMQLFQFQIESEKEKGKLKDEMIKDLRADKLRLHLAHKEKAPPLMKKKEEMVEK… |
| A0A4E0R5L7 | 1-250 | MIALPDTELRANILRLSADYVRLLAREQQDTADGPYRSLGTNYDMKKTMAVLLNEMNIRVEQLDAQVKELSARVTGSGTESRSLSPS… |
| A0A5C6NU35 | 2-198 | None |
| A0A673Z4S2 | 48-275 | None |
| A7RGB4 | 42-267 | None |
| A0A673D0S9 | 4-243 | None |
| Q4SSE2 | 43-284 | None |
| R7T9E6 | 44-284 | None |
| A0A401NPL5 | 43-260 | None |
| A0A4W4HB08 | 15-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.