DPCstruct | MC12077
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 8.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 45.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CF71 | 1-91 | MRVRDIQVVCHPVPVLATFSYPKMKCTGVVDGSRLTWFDLGPMVSQMITYQNEDRLYFALGPERNSIVTARDPTDRWIGISLSEYHR… |
| A0A4E0R3W0 | 1-95 | MNGPKLPNWMTAFNRSYLHVEEKMIVCYPSNIGIDIRGSKMICVCTIEGSPLMGFQLGPMVSQVISYQEQDRIFIGIGPERQSIVSS… |
| A0A2H1CGI4 | 43-152 | None |
| A0A4E0RTZ0 | 38-143 | None |
| A0A4E0RTL5 | 106-214 | None |
| A0A5K4F9L2 | 347-439 | None |
| A0A5K4F3Z9 | 21-109 | None |
| A0A5K4F3W0 | 1650-1731 | None |
| A0A2H1C204 | 265-373 | None |
| A0A2H1BWT5 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.