DPCstruct | MC12075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 177 ± 30 aa |
| Standard deviation of domain lengths | 29.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 57.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08926 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7X1K0 | 48-177 | DPQLLRLISDGATRFLHHQLCEIAADCLQKSRDDLLNCVYFCSMSVRLDETLAEAEMKVGPESYKYLFRLVKQMLMIVSRTARLLEC… |
| L5M1V0 | 1-148 | MEGRLQEFLTAYSPGAQLALADGVLGFIHHQIVELARDCLAKSGEALVTSRYFLEMQEKLERLLQDAHERSDSEEVGFVVQLVRKLL… |
| A0A4W5PKC0 | 62-287 | None |
| A0A3P9KUC1 | 107-322 | None |
| A0A1I8GPS6 | 91-267 | None |
| A0A669EFW7 | 162-325 | None |
| A0A667YY58 | 175-351 | None |
| A0A4D9E2T3 | 46-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.