DPCstruct | MC12072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 30.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4TAK7 | 22-135 | QPYQPHQPHQNEVLRDTKTQDDVKPLVTWNQFEVQMMDIITALRYMLMAEIPRKSVIKDEKLTALKLWVHAMKKYMPGTIPIRKLLY… |
| A0A2H1CV63 | 1-109 | MPISPVFCRIKIVIRTFYKHETPVYAVDIFRGLSAIFESDMVMFTRITGEERLAVLEFISLLEKILPASKTYRQNLTAIHKWVSERE… |
| A0A0R3TKG9 | 195-291 | None |
| A0A0N4VKX1 | 233-336 | None |
| A0A077YX42 | 699-804 | None |
| A0A1I7XGP0 | 224-335 | None |
| A0A183VFZ8 | 8-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.