DPCstruct | MC12071
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 180 ± 25 aa |
| Standard deviation of domain lengths | 25.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08427 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9XTU0 | 63-240 | YQWKELWTSLISLLKFIITNEGNLAKKMNVFHLAHQVVNIFNLFITYGDTFLYSPANYDELYYELIRMHQVFDNLYSMAFRYSAIEG… |
| A0A2H1CUQ5 | 23-200 | ITLLNLLQFVRNLDDSYAPVIVGLGLIQKVLELFNLCILQGDAFLQSAGVYDDLYYELIRMHQLFQNLHEYALLHSTSADPELKAVA… |
| A0A2D4IAF5 | 2-167 | None |
| A0A4Q2DV25 | 1-179 | None |
| A0A4V1XU28 | 367-566 | None |
| U9TIK4 | 8-187 | None |
| K7FJH7 | 85-207 | None |
| A0A4Y8CWL4 | 158-354 | None |
| A0A7S3GBS2 | 72-246 | None |
| A0A6F9C789 | 33-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.