DPCstruct | MC12069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 149 ± 12 aa |
| Standard deviation of domain lengths | 11.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5E870 | 841-976 | TSGYSELKKDDARAQLMKEDPELAKSFIKTLFGVLYEVYSSSAGPAVRHKCLRAILRIIYFADAELLKDVLKNHAVSSHIASMLSSQ… |
| A0A2H1CTB3 | 1-144 | LDHDRPVGWEENTQSLQLIQTLLPLLFELFTETTKLQTRLRCLEAIQRMLFYSSPVLLAKVLRPRHVCSHIVGMLNSPEKRILLAGL… |
| A0A7F8RE70 | 811-947 | None |
| A0A817EHM9 | 83-238 | None |
| A0A1D6QVD6 | 1-173 | None |
| A0A7J7K7T1 | 66-204 | None |
| A0A821YFX0 | 70-226 | None |
| A7T9F6 | 26-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.