DPCstruct | MC12068
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 5.75 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 44.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0K1E4 | 117-205 | TDALYALARTSVGLGAFRSARAALEVLSGRVLPSTWRNEVDKAALTVQAYPPDDRREVQRMCFRCGTLNPVLGTRGDACASCGAGFF… |
| A0A3P7NDC6 | 16-104 | QVLINYTMARIGRELGAYKLARDTLDRLGSLRVPPRLQRDVELMTVNIRAKPFSDAEDLLPVCHRCGLNNPLTCGMNCVHCKTPFQF… |
| A0A7J7JAK6 | 84-175 | None |
| A0A2J7ZZ26 | 597-685 | None |
| A0A2H2J4X8 | 2-77 | None |
| A0A7S2RZW4 | 375-468 | None |
| A0A1I7S260 | 113-200 | None |
| A0A7R9P600 | 5-106 | None |
| A0A7S2PEU5 | 32-125 | None |
| A0A0T6B3Z4 | 428-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.