DPCstruct | MC12066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 234 ± 35 aa |
| Standard deviation of domain lengths | 34.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 75.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821JCD2 | 15-232 | FNTVLSLARSLAVQRPAALEKVQKLLCMCPVDFHGVFQLDERRRDALIALGIFLVESDLQHKENIVPYLLKLLRGLPKVLWIEESTS… |
| A0A2H1CQ09 | 1-278 | TEMRGPQKALDGSVYISLARSIAFCNDYSIVKKLYDCCPSQEPQGGFRLDGPSQSAVIGLALFLVESNLKHVEKFLPYLLSIQQRLH… |
| A9JRB4 | 1-202 | None |
| A0A3P7EVW6 | 1-282 | None |
| A0A821S6J2 | 10-315 | None |
| A0A812C7S3 | 2-202 | None |
| T1GS00 | 3-195 | None |
| A0A817FZS3 | 8-221 | None |
| A0A158QIG3 | 1-277 | None |
| A0A6P3GMB3 | 1-199 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.