DPCstruct | MC12065
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 152 ± 19 aa |
| Standard deviation of domain lengths | 19.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CPF7 | 1-144 | MLGFFSLIGLCRLHCLLGDYYTAIKVLENIKISRLVSYSFVWDMYHEVPTCHITTGYYVGFSFMMMRRYLDAIRTLSATLAYKSRAI… |
| A0A433PQH0 | 276-409 | MLGYFSIVGLLRVHCLLGDYTLALKMMDNIELNKKALFARVTACHVTTYYYVGFAYMMMRRYADAIKAFSHILVFIQRTKQYHTRSY… |
| A0A4Y7NGR5 | 53-246 | None |
| A0A0V0XVW1 | 252-385 | None |
| A0A4Y7M7E7 | 134-313 | None |
| A0A1W0X8J8 | 298-447 | None |
| F0WLC0 | 207-373 | None |
| A0A2U3E2G1 | 325-458 | None |
| A0A7S1B2Z5 | 229-362 | None |
| A0A1Q3EP91 | 304-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.