DPCstruct | MC12064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 155 ± 11 aa |
| Standard deviation of domain lengths | 10.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 53.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821CCM2 | 285-422 | QDMDYILNCVDINQDGKIDFMEFTERFHNPARDIGFNMAVLLTNLSEHMPHDIRLQRLMDKGKSFLSYFQDHLGRIEIKGGAGYIER… |
| A0A2H1CNV6 | 6-158 | EEISYIIACVDTNADGKVDFKEFTERFYNPAEDIGFNFALLLTNLSEHVPFDPRLERLVEKARGVLDVFEPHLGRIEITGSNGRIER… |
| A0A821JZC0 | 110-266 | None |
| A0A3B3INL7 | 50-231 | None |
| A0A7J6PI07 | 206-364 | None |
| A0A6F9CKB1 | 10-174 | None |
| A0A2R7WGW6 | 415-570 | None |
| A0A834DAY0 | 108-274 | None |
| A0A1Y3EPZ2 | 2-154 | None |
| A0A1S3T2W2 | 229-377 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.