DPCstruct | MC12062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 281 ± 60 aa |
| Standard deviation of domain lengths | 59.96 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CLR2 | 153-379 | LEPALAFQLELNRMRNYELEQLPCLNRRMHLYLAKSKASCSTFSPLLQFSCYYFLTFFVRCIIRHADLLSREASFEFLQSEAERTLL… |
| A0A1W9VDC7 | 5-377 | IMGRRFNRDRDFERGKLLGKNGLNAYYCESGNLDIDLLHKEITTVLKESDLKDSLICDLADLSGAEEDLSINLIILSERKADKDYLN… |
| A0A2T6ZQT5 | 522-740 | None |
| A0A821UC68 | 221-501 | None |
| A0A7R9A190 | 267-563 | None |
| A0A836AMR0 | 406-631 | None |
| A0A0U0WC58 | 101-473 | None |
| J9EE75 | 84-282 | None |
| A0A1S3J5V5 | 20-294 | None |
| A0A0C9VFA2 | 133-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.