DPCstruct | MC1206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.96 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 50.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12989 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4TWJ1 | 6-68 | SINDNGCSTCEQGNENYTTFRPAHRPNQTFYQYDYRHTDGELFLTVAPTLVECRSRRDKWLEK |
| A0A414M1J2 | 3-67 | SITKNGVSTTTEKGQEKFVKCVLDAFRGTEYFQYDYRHTDGELFSTVAKTLEECCRRRDEWLQKK |
| A0A3A9AHS0 | 3-56 | None |
| A0A017MZY5 | 2-65 | None |
| A0A7V1ZUV6 | 6-58 | None |
| A0A840CPT9 | 5-68 | None |
| A0A840CQ56 | 2-66 | None |
| A0A7J5LLN9 | 1-69 | None |
| A0A6M3L1K2 | 2-62 | None |
| A0A644VE05 | 40-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.