DPCstruct | MC12058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 176 ± 25 aa |
| Standard deviation of domain lengths | 24.82 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S9HBX8 | 2-167 | KAQQLARAKKQAAGCLFIAAILFIITTLLEHSFSQAGWLAYNAFFKMVSEAALVGGLADWFAVTALFKPIPPQYPIPHTNIVAANKS… |
| A0A377TMP0 | 7-169 | KLAELKRAKLLALSLLLIAAAIFITTLALPPSPWVGALKAISEAAMVGALADWFAVVALFRRIPLPFVARHTAIIPRNKDRIADNLG… |
| A0A085JQ36 | 3-193 | None |
| A0A1I2UA36 | 4-167 | None |
| A0A381GDF3 | 28-190 | None |
| A0A4D4L7M5 | 41-202 | None |
| A0A6N8Q5A4 | 2-133 | None |
| A0A6G2U3N0 | 37-266 | None |
| A0A4Q6EIR3 | 4-179 | None |
| A0A2Z5Y9I2 | 20-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.