DPCstruct | MC12055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 144 ± 24 aa |
| Standard deviation of domain lengths | 23.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 17.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B1G002 | 126-250 | AKSTYEYFEKSKLKIKGEQSWYFDVDIVESKKKTAFKYTFTKEENPNRSDDECMEGVYFQIPKDSKNFKYRDEELKKAKLYYKRICF… |
| A0A0A2MLV6 | 14-154 | SVCPEDGACTLELQKNKSIAVKTDITGKLYCDLEDHPGTSVIHYVYTRNTDPELQDGQHREEIIFEIDNTVSELDLNNWNLSQTKMI… |
| A0A2E5G457 | 5-157 | None |
| A0A7L5G8B5 | 14-171 | None |
| A0A5B8YEM5 | 12-214 | None |
| A0A0L8AKX3 | 3-136 | None |
| A0A150XDV8 | 6-116 | None |
| A0A1I4ZCI6 | 35-196 | None |
| A0A7X0V5H0 | 4-132 | None |
| A0A6N4AD92 | 2-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.