DPCstruct | MC12054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 15.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662RS66 | 4-109 | RRVLWLSRHEPQEKQIKELEKVFGGIEIVQVSKTVSGAMEVLKLMQENETDELVAVLPIGLIAELTEKGVHPLRAVMKRELNEQGEA… |
| U2UNB5 | 1-121 | MERCFLNHTNHPSDRWGKEQMRAASSYGVVEDLPFPAVLPGWTTEQVDALAAAYAARILDREPAAVLCQGESCYVFSLVTRLKAAGI… |
| A0A3R9RUE0 | 1-138 | None |
| A0A8B2DG47 | 588-704 | None |
| A0A2J6IG67 | 1-97 | None |
| A0A7U6KKD0 | 288-392 | None |
| A0A6M3K256 | 2-165 | None |
| A0A2H0YQ78 | 2-113 | None |
| A0A7Y5V227 | 1-120 | None |
| A0A2N3G5J3 | 165-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.