DPCstruct | MC12053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 5.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 60.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08497 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V1V3V7 | 19-90 | TAPFLPTTRKEMDELGWDSCDIIIVTGDAYVDHPSFGMAIIGRLLESQGFRVGIIPQPKWDNKDAFMELGKP |
| U2UKP9 | 3-66 | EFLPVSRADMKARGLDQLDFVFVSGDAYVDHPSFGPAIICRVLESHGYKVGIIPQPDWRSDRDF |
| A0A2N9MGB9 | 55-119 | None |
| G8ASV0 | 36-101 | None |
| A0A349RF95 | 9-74 | None |
| A0A7C2GXQ2 | 16-70 | None |
| A0A699GF14 | 345-410 | None |
| A0A377AGU5 | 33-97 | None |
| A0A376VDZ5 | 33-97 | None |
| A0A3S4FI70 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.