DPCstruct | MC12048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 234 ± 46 aa |
| Standard deviation of domain lengths | 46.44 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04168 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090WQK0 | 1-252 | MLSRVANNLIWLDRYMERGSGILSLLKVNYYANQDSPELFSWTPVIKNFTAFDNEYYTEDALECIDFMVFNTNNSNSILNIVTKARE… |
| A0A7Z8ETC4 | 25-262 | YLLRDRDNPSSVLSCIEAARSNARMVRTALTREAWESVNGAWLALRRALAQPVPESELPAVLDEVKRETALILGSFYSTMLRNEIFD… |
| A0A6N3UFE4 | 17-263 | None |
| A0A3L7WTC9 | 11-207 | None |
| A0A2V7Y9Z6 | 15-205 | None |
| A0A1V3WDA2 | 139-429 | None |
| A0A1N7LK32 | 591-855 | None |
| A0A655AEC6 | 2-144 | None |
| A0A7Z1GVR0 | 29-236 | None |
| A0A2V6R5P2 | 101-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.