DPCstruct | MC12045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 136 ± 26 aa |
| Standard deviation of domain lengths | 25.55 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5Q0NUT9 | 5-159 | VLRPLADAFMQVGVFVALLVAPFGWAHYRWGGRLDELVVRYRRLAPLVAALLTMPPGCGGAILVVAAYARGAVSYGAVVAALVATMG… |
| A0A5Q0NTI5 | 157-267 | FVTVWVAAAYLAWSLLSHTTGFDGSQLPVLGLAGVVVGALVGLVPGCAIQIVFTGLFLAGGMPLPTLVANMVSQDGDALLPLMALEH… |
| A0A7C1QCR1 | 13-200 | None |
| A0A8A6BFT3 | 11-168 | None |
| A0A350IFM5 | 80-188 | None |
| A0A4R6MID0 | 203-319 | None |
| A5L5D9 | 48-190 | None |
| X1HKF1 | 2-116 | None |
| A5L5D8 | 1-109 | None |
| A0A2E5NHU1 | 20-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.