DPCstruct | MC12043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 71 ± 19 aa |
| Standard deviation of domain lengths | 18.81 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 62.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0357 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0ZQR8 | 10-70 | FNQNTFYTLDHIQEVLDKWTQIDDEIWAKVIVLERNRRVAKAYARAPILTVNGSDEGFDGY |
| A0A0J7K7L6 | 26-91 | EDVWYNLDKLYKDHIQEVLDKWNQIDDEIWAKVIVFERNRRVAKAYARAPVLTINGSNDGFDGFRI |
| A0A0M4E7Z2 | 7-93 | None |
| A0A1A9XY28 | 48-97 | None |
| A0A1B0BKU4 | 3-48 | None |
| A0A0N5CRV9 | 11-91 | None |
| A0A0M3IRL3 | 2-96 | None |
| T1KQ28 | 80-171 | None |
| A0A182G7W4 | 41-109 | None |
| A0A7R9AJI1 | 2-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.