DPCstruct | MC12042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 9.43 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5AP10 | 1-87 | MAAPHTAGAVALILGAKPGSTYETVYKLITDTADTASLKPSGANCGGVSDATYPNNDFGYGRINVFKATSSGPAPSSPAPTTTKPAC |
| A0A3L6V0R4 | 95-180 | PHVSGAIALYLSANKGASYDQVYRALTENVDTDTLTPPNKTCGGIPNTQYPNNLFGHGRLNIFKAVAASIPGLTLPSQSKSTQALN |
| A0A5D6XK10 | 268-375 | None |
| A0A397CBQ8 | 130-217 | None |
| K3X3V5 | 33-139 | None |
| A0A6G0WKV3 | 131-224 | None |
| A0A418FA61 | 167-251 | None |
| A0A6A4Z4A0 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.