DPCstruct | MC12040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 258 ± 51 aa |
| Standard deviation of domain lengths | 51.16 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0QZL6 | 280-509 | SIDIRYKLRPPTLVAAYNRLQDVVSEHLATSAARFASFASLPSVVLTPTPPRWRGDYTFYGGDPMCLLGSGTPHVQQSFDFYDDCSQ… |
| A0A6A4Z2Y5 | 13-304 | GFWNDLDACAQTAKYASIHPPNAFDAMGNSYYRSPAGTPGTALLRSQLGAAEGCPCVSKQLVQRGAASPQHYLRIPEPSLSVPPTTT… |
| A0A6G0WPY0 | 305-606 | None |
| A0A3R7X2N8 | 3-184 | None |
| A0A1V9Y8R9 | 2-305 | None |
| A0A1V9YS04 | 61-372 | None |
| A0A1V9YSC7 | 229-463 | None |
| A0A1W0A233 | 6-228 | None |
| A0A067BIZ7 | 193-441 | None |
| A0A067BSN5 | 41-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.