DPCstruct | MC12037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 216 ± 23 aa |
| Standard deviation of domain lengths | 22.91 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 25.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7CXL8 | 95-286 | FGVPFDSFVVDAVSRVVDVVCSSQYPGFQDESQLCGFTLLSSVLAMSSGNLQQLAWTVLNAVQVPNDQGHQAAKGGSITTTRNVSTT… |
| A0A6A4YUH6 | 11-206 | LKLLNYTTDIVCATQFPGFNGATNQTCGFSWFQAFTSTQPAGNAAQLVERLLTSLQIPNDQGCAAAQGNPFVTTAGVPIAQLFSKPI… |
| A0A6A3R5I2 | 1-265 | None |
| A0A485KPM1 | 204-410 | None |
| A0A485KC86 | 165-349 | None |
| A0A3R6VKW1 | 38-243 | None |
| A0A0W8DK14 | 1-237 | None |
| A0A6A4CFD5 | 31-258 | None |
| A0A7S1BPV6 | 346-566 | None |
| A0A397E5G9 | 118-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.