DPCstruct | MC12035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 82 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 92.39 |
| Assigned Pfam label(s) | CL0023- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A075FKN1 | 4-84 | VKSDIEIARAAKMEPIKDVLAKLNIPDEPATFSPMGRHIAKLNLEYIDKIKAKSNNLILVSAITPTPAGEGKTTTSVGLCD |
| A0A425DER6 | 10-108 | AAGRFRALSTWHLKRLPLQVQVPTPCDGVIASAQTPKRIETLAAEIGIDAADELKTYGPFKAKVSLDVLKRLHHQPNGKYVVVGGMT… |
| A0A0D8XA69 | 73-162 | None |
| A0A6S8SSP5 | 365-435 | None |
| A0A540K4L6 | 9-106 | None |
| R5Q2S8 | 4-69 | None |
| W4UC10 | 4-103 | None |
| A0A257JC61 | 3-71 | None |
| A0A3Q7X2M7 | 237-312 | None |
| H3AAF4 | 2-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.