DPCstruct | MC12034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 161 ± 18 aa |
| Standard deviation of domain lengths | 18.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4DDQ4 | 99-251 | MSDGRRGYWTLRLSIDLEHLGCLNESLLVAEDGLLDPWVRAGSRTALQRRVLRLGKPPRRWKTPSFSESVKRKITEVHVQGRPLNCR… |
| A0A425D655 | 1-137 | MHMKQPTDARAVCDTALSDPRVFPADRMDLLRRHRRLAKTPTTEDKEVVVEGCYPTHTIDGRPLNRAVGEKSRFIGYDDDSVTVEAL… |
| A0A7R8X5J8 | 177-364 | None |
| A0A0M3IT90 | 272-428 | None |
| W4GC86 | 461-615 | None |
| A0A815IR03 | 1-194 | None |
| A0A2G8LPJ1 | 384-572 | None |
| A0A2H9TFB0 | 769-909 | None |
| A0A238F501 | 559-728 | None |
| A0A024FTF2 | 396-553 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.