DPCstruct | MC12033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 127 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7C4P1 | 23-153 | GEPAPARALHRLYTPPAGTGPFHQMTRLVRHGDRSAAAALLEMVRTPHAVWFGDDSPEEAEQLVRETTRRAVRRGHVPVLALYNTPG… |
| A0A425BZ73 | 1-118 | MAFSPDELPLCGGPVLTYGAAKSTYPALADALTIVEQHPMATWWTDNNSTYRAQVETLMGHCNASTVPTIVVYALPQKDCHAGYSNL… |
| A0A6G0WYL8 | 1-126 | None |
| A0A485KYU8 | 18-133 | None |
| A0A1W0A6C4 | 8-115 | None |
| A0A0P1AFE1 | 915-1049 | None |
| A0A662WX52 | 13-143 | None |
| K3WJC9 | 2-112 | None |
| A0A067C8E0 | 257-375 | None |
| A0A0A7CL79 | 18-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.