DPCstruct | MC12030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 284 ± 30 aa |
| Standard deviation of domain lengths | 30.20 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 18.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7R0P0 | 290-572 | VKLSGFFGSQLSQEKLKANLFLGDEAWENHIHIAEDYRYFEGEIGFLLTFIDADSYKEWTEGEHKQKQSSFTSYYEKAIEIFGETKL… |
| A0A346S3I6 | 38-319 | GFTPAQREEEQLKASLILEDPSWESLFERFEVHVYLKGKLGFLLDMAREPDDSINYETFEYLATKAASVLSDEIRASKEQLLERALL… |
| A0A518VN37 | 1-277 | None |
| A0A419W3K5 | 499-807 | None |
| R6FI96 | 19-243 | None |
| A0A806KMU6 | 2-250 | None |
| A0A7X2W4Q4 | 215-510 | None |
| A0A7Y4ZIM4 | 49-325 | None |
| A0A6N4YUZ2 | 131-430 | None |
| A0A6D0FIK8 | 307-643 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.