DPCstruct | MC1203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 70 ± 6 aa |
| Standard deviation of domain lengths | 6.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 66.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182T3L6 | 142-211 | NLGSQLLKELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCAPKVQATLDLQSGIL |
| A0A3S5FFI1 | 3-73 | YHLGTNLLKELKKLDDKVLLVEVQLLESQIYYRVGNLQRSRAALTSARTTANGIYCPPRLQASLDLLSGSW |
| F0XTV6 | 147-217 | None |
| A0A2I0T3G5 | 1-54 | None |
| A0A0C3AUU6 | 126-192 | None |
| Q5BTH7 | 14-84 | None |
| M9LK50 | 150-218 | None |
| A0A7R9C3C5 | 222-292 | None |
| A0A402G3P4 | 1-64 | None |
| A0A409WXY9 | 39-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.