DPCstruct | MC12027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 17.92 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 34.00 |
| Pfam Score | 88.40 |
| Assigned Pfam label(s) | CL0010- CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9JB53 | 23-119 | RTVGLWVQCDDCDRWRYLPNVLDSSELPKKWYCRLHPDSTSADCSIPEAPLRIREEEDLIHGDYSAGSVVWARLDGWPWWPAMVDDC… |
| A0A158NZ49 | 13-125 | QRDIGIFIQCCRKSCKKWRYCDDFHDPVDVPKLWYCKMNSNKAIASCFVPEVPKMEAVEEDLIENKYNCGSLVWAHMHNYLWWPAIV… |
| A0A5K4FDB4 | 101-216 | None |
| A0A654HRD9 | 605-708 | None |
| S4RQ36 | 4-96 | None |
| S4RQ33 | 1-89 | None |
| A0A4W3GBP1 | 2-93 | None |
| A0A6L5DG22 | 83-177 | None |
| A0A4W3GBY2 | 6-107 | None |
| A0A4W5NY88 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.