DPCstruct | MC12026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 10.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 58.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0A3T4 | 330-408 | IAKVNRLNMGAYLCIASNGIPPTVSKRVMLIVHFPPMIWIQNQLVGAAIGQNITLECQSEAFPKSINYWMKNDTIIVPG |
| H9JA10 | 3-92 | QLVETYRGESLELSHVQRNDMGTYYCIASNGVPPTVSRRYQVEVHFIPQVKVTNQLVGAPLGSDVELQCYIEASPKAMNSWSREDGN… |
| A0A6A4WVG7 | 443-549 | None |
| A0A484B2P9 | 242-321 | None |
| T1GMI6 | 1-68 | None |
| A0A1A9VCJ6 | 8-87 | None |
| A0A7R8HBZ0 | 202-282 | None |
| A0A653DHB3 | 33-114 | None |
| A0A151HZG4 | 34-127 | None |
| A0A6L5DKX8 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.