DPCstruct | MC12019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 63 ± 11 aa |
| Standard deviation of domain lengths | 10.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 43.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H9ISF6 | 25-81 | KPLKVNREIAGLERLIEELHGIFSRSHVNVQDVQKLMAGYKSDPKDWRKYAKFDRFR |
| A0A5E4QTT5 | 31-83 | KVDIEIPSLKILIEELHRVFENNYVNIQHVQKLMAAYKSNPKDWKKFAKFDRY |
| A0A833RW28 | 83-139 | None |
| A0A7J7XYQ4 | 2-56 | None |
| A0A7J7XY25 | 2-76 | None |
| A0A443SSU6 | 2-58 | None |
| A0A7R9QPX9 | 1-59 | None |
| A0A401KS74 | 1-89 | None |
| A0A3Q0JIQ3 | 70-136 | None |
| A0A7R9HRN4 | 37-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.