DPCstruct | MC12017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 4 aa |
| Standard deviation of domain lengths | 4.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 50.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9QK30 | 1-68 | MDFHSLSRRDLQALCKKNRIPANVTNVAMADALQALQTVEGIEEIKEAAQFQSPTSWRTSARRVPVPD |
| A0A2Z7AGL2 | 1-62 | MEFHSLTKRELQSLCKMNKIPANMTNIAMADALKSLEFVEGIEEFLQPKESESAQSSMESPA |
| A0A6A5LKN2 | 1-62 | None |
| J3M0Z9 | 1-62 | None |
| A0A0A0KKZ3 | 1-62 | None |
| K3Y4U6 | 1-67 | None |
| A0A836DEF6 | 1-76 | None |
| A0A446VKB5 | 11-73 | None |
| A0A6D2J1C3 | 1-72 | None |
| D7T7T7 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.