DPCstruct | MC12014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 134 |
|---|---|
| Mean domain length (aa) | 244 ± 44 aa |
| Standard deviation of domain lengths | 44.37 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.43 |
| Pfam Score | 87.78 |
| Assigned Pfam label(s) | CL0039- CL0235- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z7A2D6 | 2-275 | SKILVIAEHLDGKLNPSTARAVSAAAAVKPEAVDVLVLADNAAAIAAEAARIGGVSRVLTVERAENAHPLAAVLAPQIAKAAAGYSH… |
| A0A837U159 | 1-181 | ATEVIAVSVGVTQAQETLRTALAIGADRAILVESNDSVEPLAVAKILKALVDKEQPQLVILGKQAIDDDSNQTGQMLAALAGLPQAT… |
| A0A0Q4B792 | 19-200 | None |
| A0A1S3G323 | 59-311 | None |
| J4UGW4 | 19-315 | None |
| A0A2V2E5V5 | 9-213 | None |
| A0A7Y0N5V7 | 71-340 | None |
| R7TU78 | 1-215 | None |
| A0A2R6FL14 | 169-532 | None |
| A0A538Q374 | 9-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.