DPCstruct | MC12012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 123 ± 15 aa |
| Standard deviation of domain lengths | 15.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9HAF1 | 2-111 | ENQIKKWKISTIVLSILVVILVVILIKPSFGSPQKIGEDTIGYINQELLAGQGTATLGGIKKSEIIDGMYEVELDIQGDTFKSFVTQ… |
| A0A0G1ISZ9 | 1-117 | MQDKKIIAISLILIALGAGAYFYSAKGNIGGASAKQMEAIRVKAEKFINEKLVSPGTNATIKNIVEENGLYKISVSIGSQEIISYLS… |
| A0A523XYC0 | 7-121 | None |
| A0A497I840 | 3-103 | None |
| A0A5E4JZS4 | 7-138 | None |
| X1L0X2 | 2-126 | None |
| A0A2G9M4E9 | 109-240 | None |
| A0A1S6HC76 | 164-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.