DPCstruct | MC12009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 427 ± 34 aa |
| Standard deviation of domain lengths | 34.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 15.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4NQB7 | 1-481 | MRIDSTWHASVGGLLFQVSIETGFGDVYLVDPERPHHPGFKLASDGQGHWRLDRGARLEGGMPRERVQRWKDANQIHLDALTAQAQQ… |
| A0A449IN61 | 3-370 | GEGLYPVHIDSEDNVAISSNTDINRIGPNLRTDGKGNWFVDTRLRLQAGGLSRRIASLQAQKARRKSELQTQLTDFYPLEAPRQKAV… |
| A0A2W0ERT5 | 2-409 | None |
| E0WSL0 | 194-622 | None |
| A0A1H1ZNB3 | 533-966 | None |
| A0A1N7U7M4 | 205-570 | None |
| A0A2N5EXZ3 | 361-799 | None |
| A0A6L5I8M7 | 174-623 | None |
| A0A7C8XN70 | 19-460 | None |
| A0A3C1AJK3 | 386-848 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.