DPCstruct | MC12008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 229 ± 53 aa |
| Standard deviation of domain lengths | 53.01 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5H2YAI8 | 3-229 | ISAAFLDEASKWLNGEGYEEKSVENALQLACSNKPESSSLDNSSEEMAMVGLDAMQRANSTLEDFCRSYFMFHGMDINKPQSVFQYL… |
| A0A815AY39 | 34-232 | LNPDHNVVLSFHGLRKARRVLEYISCQYMYYHNLEPKDFMTYMDILTFVESAIYLIDEVNEEADENEKRFKFDFSNKNILSDNEFFD… |
| A0A388L7R2 | 107-384 | None |
| A0A1D6E9E8 | 24-209 | None |
| A0A061DHW9 | 64-278 | None |
| A0A484MWY7 | 2-206 | None |
| A0A6V7P3G2 | 63-286 | None |
| A0A4D9A949 | 17-235 | None |
| A0A453C3G9 | 3-165 | None |
| V4LBF2 | 1-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.