DPCstruct | MC12004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 4.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 73.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H6R0K1 | 2-57 | TEQAADAAVDQACRMLRLPTVRSQFNEIAEAATRDQMTYRAFLADLLLAECDDRAR |
| A0A4R7HTU8 | 1-70 | MTVKRHRGLTEQAADAAVDQACRMLRLPTIRAQFPDLAEAAARDQMSYRGFLAELLMAECDDRARPPLGA |
| A0A1K2FAS7 | 488-552 | None |
| A0A0N1NWK5 | 66-128 | None |
| A0A7W7ZZ25 | 1-69 | None |
| A0A7I9WC35 | 2-59 | None |
| A0A7I9VZL1 | 314-376 | None |
| A0A7W5T0P3 | 2-71 | None |
| A0A7I9VY00 | 232-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.